Africanamericanaffinityatwalker.org - Website informatie

Informatie over de website africanamericanaffinityatwalker.org.

AFRICAN AMERICAN AFFINITY GROUP | at the Walker School AFRICAN AMERICAN AFFINITY GROUP | at the Walker School

Updaten

De geschatte waarde van africanamericanaffinityatwalker.org is € 92,81. Dit is onder andere gebaseerd op 99 paginaweergaves per dag, waardoor we schatten dat het domein € 7,53 per maand oplevert aan advertentieinkomsten. De website is gehost in SALT LAKE CITY, UNITED STATES en heeft een Google Pagerank van 0. Deze informatie is voor het laatst bijgewerkt op 27 juli 2014 om 04:08.

Informatie over het domein

Domain value history for africanamericanaffinityatwalker.org
Registrar Niet beschikbaar
Domein geregistreerd op Niet beschikbaar
Huidige geschatte waarde € 92,81
Dagelijkse ad-inkomsten € 0,25
Paginaweergaves per dag 99
Verkeer
Staat in DMOZ database Nee
Staat in Yahoo database Nee

Informatie over de website

Auteur Niet beschikbaar
Favicon Favicon africanamericanaffinityatwalker.org
Taal en-US
Google Pagerank 0/10
Alexa rank Niet beschikbaar
Gebruikt Google Analytics Nee
HTML-opmaak Check
Doctype Niet beschikbaar
Paginagrootte 35 kB
Backlinks Niet beschikbaar
Door zoekmachines geïndexeerde pagina's Niet beschikbaar

Informatie over de server

Server IP 192.254.190.187
Server hostname (reverse DNS) Niet beschikbaar
Server locatie SALT LAKE CITY, UNITED STATES
Afstand tot server (hemelsbreed) 1.126,2 km
Datacenter / ISP Unified Layer,US
Gemiddelde ping tijd (vanuit Nederland) 137,05 ms
Laadtijd pagina 1,19 sec
Servertype nginx/1.6.0
Powered by Niet beschikbaar
Nameservers ns6399.hostgator.com, ns6400.hostgator.com
Mailservers africanamericanaffinityatwalker.org

Afstand tot server

Andere websites gehost op 192.254.190.187